| Primary information |
|---|
| ID | 13274 |
| Uniprot ID | D2Z1D6 |
| Description | Pigment-dispersing hormone peptides (AvPDH) [Cleaved into- PDH precursor-related peptide (PPRP); Pigment-dispersing hormone (PDH)] |
| Organism | Armadillidium vulgare |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Peracarida; Isopoda (pill bugs; wood lice and sea slaters); Oniscidea (pillbugs); Crinocheta; Armadillidiidae; Armadillidium; Armadillidium vulgare (Pillbug) (Pill woodlouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod PDH family. |
| Tissue Specificity | Expressed strongly in the head and weakly in the ventral nerve cord. Not detected in the midgut cecum or hindgut. In the cephalic neural complex; specifically localized to cells within the optic lobe; |
| Post Translational Modification | NA |
| Function | The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator. |
| Length | 82 |
| Molecular Weight | 9 |
| Name | Pigment-dispersing hormone peptides |
| Sequence | QDLNPTEKEVLSNMLDFLQRHSRTTYMFPLLSES |
| Sequence map | 816 |
| PDB ID | 20637211 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|