Primary information |
---|
ID | 13262 |
Uniprot ID | C0HJI6 |
Description | Insulin-2 [Cleaved into- Insulin-2 B chain; Insulin-2 A chain] |
Organism | Thunnus orientalis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Pelagiaria; Scombriformes; Scombridae (mackerels); Scombrinae; Thunnini; Thunnus; Thunnus orientalis (North Pacific bluefin tuna) ( |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insulin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver. |
Length | 51 |
Molecular Weight | 5 |
Name | Insulin-2 |
Sequence | VAPPQHLCGSHLVDALYLVCGDRGFFYNPK |
Sequence map | 720 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|