| Primary information |
|---|
| ID | 13259 |
| Uniprot ID | Q99MP5 |
| Description | Promotilin [Cleaved into- Motilin; Motilin-associated peptide (MAP)] |
| Organism | Cavia porcellus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Hystricomorpha; Caviidae (cavies); Cavia (guinea pigs); Cavia porcellus (Guinea pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the motilin family. |
| Tissue Specificity | Present in the gut mucosa with the exception of the gastric corpus. Also present in medulla oblongata; nucleus of the solitary tract; hypophysis; spinal cord; hypothalamus; and cerebellum but not in t |
| Post Translational Modification | NA |
| Function | Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
| Length | 127 |
| Molecular Weight | 14 |
| Name | Promotilin |
| Sequence | SLRVQQRSKAAGRLEPQEVMEEEENGVIKLTAPVEIGVGLSSRQLEKHRAVLEALLSEALPPPSLVFGGQRPVTAAWE |
| Sequence map | 1872 |
| PDB ID | 11172801 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|