| Primary information |
|---|
| ID | 13256 |
| Uniprot ID | P0DJ95 |
| Description | Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into- PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)] (Fragments) |
| Organism | Heloderma suspectum |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Neoanguimorpha (New World anguimorph lizards); Helodermatidae (beaded lizards); Heloderma; |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cells. Promotes neuron projection development. |
| Length | 56 |
| Molecular Weight | 6 |
| Name | Pituitary adenylate cyclase-activating polypeptide |
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQ |
| Sequence map | 792 |
| PDB ID | 9545315 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|