| Primary information |
|---|
| ID | 13251 |
| Uniprot ID | Q8K1M5 |
| Description | Neuropeptide W (Preproprotein L8) (PPL8) [Cleaved into- Neuropeptide W-23 (NPW23) (L8); Neuropeptide W-30 (NPW30) (L8C)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the neuropeptide B/W family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays a regulatory role in the organization of neuroendocrine signals accessing the anterior pituitary gland. Stimulates water drinking and food intake. May play a role in the hypothalamic response to stress. When injected into the lateral cerebroventricle; it elevates prolactin (PRL) and corticosterone and lowers growth hormone (GH) release. |
| Length | 185 |
| Molecular Weight | 20 |
| Name | Neuropeptide W |
| Sequence | WYKHVASPRYHTVGRASGLLMGLRRSPYLW |
| Sequence map | 720 |
| PDB ID | 12130646; 12810535 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|