| Primary information |
|---|
| ID | 13240 |
| Uniprot ID | O18845 |
| Description | Promotilin [Cleaved into- Motilin; Motilin-associated peptide (MAP)] |
| Organism | Ovis aries |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovis; Ovis aries (Sheep) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the motilin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
| Length | 115 |
| Molecular Weight | 12 |
| Name | Promotilin |
| Sequence | FVPIFTYGEVQRMQEKERYKGQKKSLSVQQRSEEVGPVDPAEPREEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLRKALPSSRNAQ |
| Sequence map | 2160 |
| PDB ID | 9427564 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|