| Primary information |
|---|
| ID | 13238 |
| Uniprot ID | P15131 |
| Description | LIRP (Locusta insulin-related peptide) [Cleaved into- LIRP B chain; 5 kDa peptide (C chain); LIRP A chain] |
| Organism | Locusta migratoria |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Acrididae (short-horned grasshoppers); Oedipodinae (band-winged grasshoppers); Locusta; Locusta migratoria (Migratory locust) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 145 |
| Molecular Weight | 15 |
| Name | LIRP |
| Sequence | ASQDVSDSESEDNYWSGQSADEAAEAAAAALPPYPILARPSAGGLLTGAV |
| Sequence map | 1200 |
| PDB ID | 1688797; 8168530; 2298206; 1935945 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|