| Primary information |
|---|
| ID | 13236 |
| Uniprot ID | Q7TSB7 |
| Description | Metastasis-suppressor KiSS-1 (Kisspeptin-1) [Cleaved into- Metastin; Kisspeptin-10 (Metastin45-54)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | Expression observed in trophoblast giant cells (TGCs); the placenta-derived cell lineage aligned at the boundary between the uterus and placenta; at embryonic days 12.5 (E12.5). Expressions gradually |
| Similarity | Belongs to the KISS1 family. |
| Tissue Specificity | Highest levels in the cecum and colon. Moderate levels present in the liver; spleen; kidney; ovary; uterus and small intestine. Low levels in the stomach; pancreas and placenta. Expressed only moderat |
| Post Translational Modification | NA |
| Function | Metastasis suppressor protein. May regulate events downstream of cell-matrix adhesion; perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide; metastin which functions as the endogenous ligand of the G-protein coupled receptor GPR54. The receptor is also essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. Intracerebroventricular administration induces an increase in serum LH and FSH levels in prepubertal male and female as well as in adult animals. |
| Length | 130 |
| Molecular Weight | 14 |
| Name | Metastasis-suppressor KiSS-1 |
| Sequence | TSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQREKDMSAYNWNSFGLRY |
| Sequence map | 1248 |
| PDB ID | 15157736; 15219839; 15242985; 15593369 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|