| Primary information |
|---|
| ID | 13234 |
| Uniprot ID | Q6Y4S4 |
| Description | Metastasis-suppressor KiSS-1 (Kisspeptin-1) [Cleaved into- Metastin (Kisspeptin-52); Kisspeptin-10 (Metastin45-54)] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the KISS1 family. |
| Tissue Specificity | Weak in all tissue types with highest levels in lung and 15- 17-day embryos. Expressed in areas of the hypothalamus implicated in the neuroendocrine regulation of gonadotropin secretion; including the |
| Post Translational Modification | NA |
| Function | Metastasis suppressor protein. May regulate events downstream of cell-matrix adhesion; perhaps involving cytoskeletal reorganization. Generates a C-terminally amidated peptide; metastin which functions as the endogenous ligand of the G-protein coupled receptor GPR54. Activation of the receptor inhibits cell proliferation and cell migration; key characteristics of tumor metastasis. The receptor is also essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/GPR54 system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. Intracerebroventricular administration induces an increase in serum LH and FSH levels in prepubertal male and female as well as in adult animals. |
| Length | 130 |
| Molecular Weight | 14 |
| Name | Metastasis-suppressor KiSS-1 |
| Sequence | SSPCPPVEGPAGRQRPLCASRSRLIPAPRGAVLVQREKDLSTYNWNSFGLRY |
| Sequence map | 1248 |
| PDB ID | 12359743; 15157736; 15489334; 15217982; 15665556; 15486019; 15375028; 15665093; 15637288; 1 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|