Primary information |
---|
ID | 13232 |
Uniprot ID | Q68RJ9 |
Description | Cocaine- and amphetamine-regulated transcript protein [Cleaved into- CART(1-39); CART(42-89)] |
Organism | Bos taurus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the CART family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. |
Length | 116 |
Molecular Weight | 12 |
Name | Cocaine- and amphetamine-regulated transcript protein |
Sequence | QEDAELQPRALDIYSAVEDASHEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
Sequence map | 2136 |
PDB ID | 15670137; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|