| Primary information |
|---|
| ID | 13230 |
| Uniprot ID | Q68RJ9 |
| Description | Cocaine- and amphetamine-regulated transcript protein [Cleaved into- CART(1-39); CART(42-89)] |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the CART family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. |
| Length | 116 |
| Molecular Weight | 12 |
| Name | Cocaine- and amphetamine-regulated transcript protein |
| Sequence | QEDAELQPRALDIYSAVEDASHEKELIEALQEVLKKLKS |
| Sequence map | 936 |
| PDB ID | 15670137; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|