| Primary information |
|---|
| ID | 13225 |
| Uniprot ID | P01184 |
| Description | Vasopressin-neurophysin 2 [Cleaved into- Arg-vasopressin (Arginine-vasopressin); Neurophysin 2] (Fragment) |
| Organism | Balaenoptera physalus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea (whales); Mysticeti (baleen whales); Balaenopteridae (rorquals); Balaenoptera; Balaenoptera physalus (Fin whale) (Balaena physalus) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney; it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B; V1aR/AVPR1A; and V2R/AVPR2). |
| Length | 107 |
| Molecular Weight | 11 |
| Name | Vasopressin-neurophysin 2 |
| Sequence | AMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFMGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGASFPRRA |
| Sequence map | 2280 |
| PDB ID | 14118277; 639997 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|