Primary information |
---|
ID | 13215 |
Uniprot ID | Q9NDE7 |
Description | Insulin [Cleaved into- Insulin B chain; Insulin B chain'; Insulin A chain] |
Organism | Aplysia californica |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Heterobranchia; Euthyneura; Tectipleura; Aplysiida (sea hares); Aplysioidea; Aplysiidae; Aplysia; Aplysia californica (California sea hare) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Expressed in the central region of the cerebral ganglia mostly within the F and C clusters. |
Post Translational Modification | NA |
Function | Involved in glucose metabolism. |
Length | 156 |
Molecular Weight | 17 |
Name | Insulin |
Sequence | NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLA |
Sequence map | 984 |
PDB ID | 10479677; 16522341 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|