| Primary information |
|---|
| ID | 13207 |
| Uniprot ID | P35318 |
| Description | Pro-adrenomedullin [Cleaved into- Adrenomedullin (AM); Proadrenomedullin N-20 terminal peptide (ProAM N-terminal 20 peptide) (PAMP) (ProAM-N20)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the adrenomedullin family. |
| Tissue Specificity | Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung; ventricle and kidney tissues. |
| Post Translational Modification | NA |
| Function | AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney; am is diuretic and natriuretic; and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland; both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume; actions which complement their hypotensive effects in blood vessels. |
| Length | 185 |
| Molecular Weight | 20 |
| Name | Pro-adrenomedullin |
| Sequence | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
| Sequence map | 1248 |
| PDB ID | 7688224; 8074714; 14702039; 15489334; 8387282; 9578982; 10588445; 16315141 |
| Drugpedia | 2FLY;2L7S;4RWF;5V6Y;6UUN;6UUS;6V2E; |
| Receptor | Q16602; P30550; Q92896; Q96LB1 |
| Domain | NA |
| Pharmaceutical Use | NA
|