Primary information |
---|
ID | 13206 |
Uniprot ID | O42144 |
Description | Glucagon-2 (Glucagon II) [Cleaved into- Glucagon; Glucagon-like peptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-like peptide 1C (GLP-1C)] |
Organism | Xenopus laevis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Promotes hydrolysis of glycogen and lipids; and raises the blood sugar level. |
Length | 219 |
Molecular Weight | 25 |
Name | Glucagon-2 |
Sequence | HAEGTFTNDMTNYLEEKAAKEFVGWLINGRP |
Sequence map | 744 |
PDB ID | 9223287; |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|