| Primary information |
|---|
| ID | 13204 |
| Uniprot ID | O42144 |
| Description | Glucagon-2 (Glucagon II) [Cleaved into- Glucagon; Glucagon-like peptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-like peptide 1C (GLP-1C)] |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Promotes hydrolysis of glycogen and lipids; and raises the blood sugar level. |
| Length | 219 |
| Molecular Weight | 25 |
| Name | Glucagon-2 |
| Sequence | HAEGTFTSDVTQHLDEKAAKEFIDWLINGGPTKEIIS |
| Sequence map | 888 |
| PDB ID | 9223287; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|