| Primary information |
|---|
| ID | 13201 |
| Uniprot ID | P07480 |
| Description | Galanin peptides [Cleaved into- Galanin; Galanin message-associated peptide (GMAP)] |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the galanin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1; GALR2; and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract; growth hormone and insulin release and adrenal secretion. |
| Length | 123 |
| Molecular Weight | 13 |
| Name | Galanin peptides |
| Sequence | ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGALGRLPGLPSAASSEDAGQS |
| Sequence map | 1416 |
| PDB ID | 2428032; 1718731; 6197320; 1381832 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|