| Primary information |
|---|
| ID | 13198 |
| Uniprot ID | P22466 |
| Description | Galanin peptides [Cleaved into- Galanin; Galanin message-associated peptide (GMAP)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the galanin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1; GALR2; and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract; growth hormone and insulin release and adrenal secretion. |
| Length | 123 |
| Molecular Weight | 13 |
| Name | Galanin peptides |
| Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Sequence map | 720 |
| PDB ID | 7508413; 1370155; 15489334; 1710578; 1722333; 14997482; 16807684; 18669648; 21406692; 23186 |
| Drugpedia | NA |
| Receptor | P47211; O43603; O60755 |
| Domain | NA |
| Pharmaceutical Use | NA
|