Primary information |
---|
ID | 13195 |
Uniprot ID | P56388 |
Description | Cocaine- and amphetamine-regulated transcript protein [Cleaved into- CART(1-52); CART(55-102); CART(62-102)] |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the CART family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. |
Length | 129 |
Molecular Weight | 14 |
Name | Cocaine- and amphetamine-regulated transcript protein |
Sequence | QEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAMLQIEALQEVLKKLKS |
Sequence map | 1248 |
PDB ID | 10612705; 15489334; 21183079 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|