| Primary information |
|---|
| ID | 13163 |
| Uniprot ID | P04204 |
| Description | Exendin-2-long [Cleaved into- Exendin-2 (Helodermin) (VIP-like 2)] |
| Organism | Heloderma suspectum |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Neoanguimorpha (New World anguimorph lizards); Helodermatidae (beaded lizards); Heloderma; |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Expressed by the venom gland. Not expressed in the pancreas; liver; stomach; small intestine; lung; heart; kidney; spleen; ovary; and brain. |
| Post Translational Modification | An amidated Pro-81 is described (PubMed-6439576; PubMed-3569266). Such an amidation is however not compatible with the sequence displayed (PubMed-9545315 and PubMed-10880980). Indeed cDNAs do not enco |
| Function | Has vasoactive intestinal peptide(VIP)/secretin-like biological activity. Interacts with rat and human VIP receptors 1 (VIPR1) and 2 (VIPR2); with the highest affinity for the human VIPR2. Induces hypotension that is mediated by relaxation of cardiac smooth muscle. This vasodilation may not be transduced by VIP or PACAP receptors. |
| Length | 84 |
| Molecular Weight | 9 |
| Name | Exendin-2-long |
| Sequence | HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPPPS |
| Sequence map | 888 |
| PDB ID | 9545315; 6439576; 3569266; 10880980; 9928018; 15003357; 19837656; 8634236 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|