Primary information |
---|
ID | 13162 |
Uniprot ID | C6EVG2 |
Description | Exendin-2-long [Cleaved into- Exendin-2 (Helodermin) (VIP-like 2)] |
Organism | Heloderma suspectum cinctum |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Neoanguimorpha (New World anguimorph lizards); Helodermatidae (beaded lizards); Heloderma; |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Expressed by the venom gland. |
Post Translational Modification | NA |
Function | Has vasoactive intestinal peptide(VIP)/secretin-like biological activity. Interacts with rat and human VIP receptors 1 (VIPR1) and 2 (VIPR2); with the highest affinity for the human VIPR2. Induces hypotension that is mediated by relaxation of cardiac smooth muscle. |
Length | 84 |
Molecular Weight | 9 |
Name | Exendin-2-long |
Sequence | HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP |
Sequence map | 840 |
PDB ID | 19837656; 9928018; 15003357 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|