Primary information |
---|
ID | 13157 |
Uniprot ID | P01360 |
Description | Atrial gland and califin peptides (ELH-18) [Cleaved into- Atrial gland peptide A; Califin-A; Califin-A large subunit; Califin-A small subunit] |
Organism | Aplysia californica |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Heterobranchia; Euthyneura; Tectipleura; Aplysiida (sea hares); Aplysioidea; Aplysiidae; Aplysia; Aplysia californica (California sea hare) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the molluscan ELH family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | The atrial gland peptide A and peptide B precursors are the source of the 2 peptides that; upon release from this reproductive system gland; initiate the egg-laying process by exciting the bag cell neurons. These neurons; clustered in neural connectives near the abdominal ganglion; in turn release other peptides that act directly on the ganglion and also; via the circulating hemolymph; on many other organs to control the physiological processes of egg-laying. One of these other peptides is the egg-laying hormone.; Injected in sexually mature animals califin A excites LB and LC cells of the abdominal ganglion and causes egg-laying. |
Length | 173 |
Molecular Weight | 19 |
Name | Atrial gland and califin peptides |
Sequence | ISINQDLKAITDMLLTEQIQARRRCLDALRQRLLDLGKRDSDVSLFNGDLLPNGRCS |
Sequence map | 1368 |
PDB ID | 4020422; 6687446; 6929554; 3753705; 3379066 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|