Primary information |
---|
ID | 13139 |
Uniprot ID | P05305 |
Description | Endothelin-1 (Preproendothelin-1) (PPET1) [Cleaved into- Endothelin-1 (ET-1); Big endothelin-1] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the endothelin/sarafotoxin family. |
Tissue Specificity | Expressed in lung; placental stem villi vessels and in cultured placental vascular smooth muscle cells. |
Post Translational Modification | NA |
Function | Endothelins are endothelium-derived vasoconstrictor peptides. Probable ligand for G-protein coupled receptors EDNRA and EDNRB which activates PTK2B; BCAR1; BCAR3 and; GTPases RAP1 and RHOA cascade in glomerular mesangial cells |
Length | 212 |
Molecular Weight | 24 |
Name | Endothelin-1 |
Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS |
Sequence map | 912 |
PDB ID | 3282927; 2670930; 2659594; 8450044; 14574404; 15489334; 2649896; 10438732; 1864385; 9284755 |
Drugpedia | 1EDN;1EDP;1T7H;1V6R;5GLH;6DK5; |
Receptor | P25101; P24530 |
Domain | NA |
Pharmaceutical Use | NA
|