| Primary information |
|---|
| ID | 13137 |
| Uniprot ID | P85830 |
| Description | Diuretic hormone class 2 (Diuretic peptide) (DP) (GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP-amide) [Cleaved into- Brain peptide GLDLGLSRGFSGSQAA; Brain peptide GLDLGLSRGFSGSQAAKH] |
| Organism | Apis mellifera |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the diuretic hormone class 2 family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a nonselective effect on Na(+)/K(+) ion transport. In vitro; primarily elevates intracellular Ca(2+). |
| Length | 31 |
| Molecular Weight | 2 |
| Name | Diuretic hormone class 2 |
| Sequence | GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP |
| Sequence map | 744 |
| PDB ID | 17068263 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|