| Primary information |
|---|
| ID | 13133 |
| Uniprot ID | Q5W1L4 |
| Description | Pro-corazonin (Crz) (De-Crz) [Cleaved into- Corazonin; Corazonin precursor-related peptide (CPRP)] |
| Organism | Drosophila erecta |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila erecta (Fruit fly) |
| Subcellular Location | [Corazonin]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the corazonin family. |
| Tissue Specificity | Expression is restricted to 24 neurons in the larval CNS (8 in the brain and 16 in the ventral nerve cord) and 12-16 neurons in the pars lateralis of the adult brain. |
| Post Translational Modification | NA |
| Function | Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. Clock (Clk) and cycle (cyc) proteins negatively regulate Crz transcription in a cell-specific manner. |
| Length | 154 |
| Molecular Weight | 17 |
| Name | Pro-corazonin |
| Sequence | SFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSD |
| Sequence map | 816 |
| PDB ID | 15669053 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|