| Primary information |
|---|
| ID | 13125 |
| Uniprot ID | P09535 |
| Description | Insulin-like growth factor II (IGF-II) (Multiplication-stimulating polypeptide) [Cleaved into- Insulin-like growth factor II; Preptin] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | At 8 dpc; 9.5 dpc and 16.5 dpc; transcripts from parental allele are detected in embryonic and extraembryonic tissues (PubMed-28522536; PubMed-1997210). At 16.5 dpc; transcripts from parental and mate |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed in the heart; blood serum; kidney and skeletal muscle including the tibialis anterior muscle. |
| Post Translational Modification | Proteolytically processed by PCSK4; proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2. |
| Function | The insulin-like growth factors possess growth-promoting activity |
| Length | 180 |
| Molecular Weight | 20 |
| Name | Insulin-like growth factor II |
| Sequence | AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Sequence map | 1608 |
| PDB ID | 3780370; 1702294; 9039503; 19468303; 15489334; 2537977; 8265819; 11716772; 2330056; 1997210 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|