Primary information |
---|
ID | 13120 |
Uniprot ID | P01344 |
Description | Insulin-like growth factor II (IGF-II) (Somatomedin-A) (T3M-11-derived growth factor) [Cleaved into- Insulin-like growth factor II; Insulin-like growth factor II Ala-25 Del; Preptin] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | During embryogenesis; detected in liver; lung; skeletal muscle and placenta. |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Expressed in heart; placenta; lung; liver; muscle; kidney; tongue; limb; eye and pancreas. |
Post Translational Modification | O-glycosylated with core 1 or possibly core 8 glycans. Thr-96 is a minor glycosylation site compared to Thr-99. |
Function | The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults; involved in glucose metabolism in adipose tissue; skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling |
Length | 180 |
Molecular Weight | 20 |
Name | Insulin-like growth factor II |
Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Sequence map | 1608 |
PDB ID | 6382022; 6382021; 2450353; 3002851; 3476948; 3683205; 3881277; 7730145; 16531418; 20842449; |
Drugpedia | 1GF2;1IGL;2L29;2V5P;3E4Z;3KR3;5L3L;5L3M;5L3N;6UM2; |
Receptor | P11717; P06213 |
Domain | NA |
Pharmaceutical Use | NA
|