Primary information |
---|
ID | 13119 |
Uniprot ID | P01183 |
Description | Vasopressin-neurophysin 2-copeptin (AVP-NPII) [Cleaved into- Lys-vasopressin; Neurophysin 2 (Neurophysin-I/-III); Copeptin] |
Organism | Sus scrofa |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the vasopressin/oxytocin family. |
Tissue Specificity | NA |
Post Translational Modification | A shorter neurophysin molecule (32-123) is called neurophysin-I and is derived from the complete protein (called neurophysin III) by proteolytic degradation (in vivo or after extraction). |
Function | Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney; it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B; V1aR/AVPR1A; and V2R/AVPR2). |
Length | 166 |
Molecular Weight | 17 |
Name | Vasopressin-neurophysin 2-copeptin |
Sequence | AMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGASFLRRA |
Sequence map | 2280 |
PDB ID | 3768139; 1971513; 4940405; 944186; 1001445; 465021; 4673067 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|