| Primary information |
|---|
| ID | 13113 |
| Uniprot ID | P01180 |
| Description | Vasopressin-neurophysin 2-copeptin (AVP-NPII) [Cleaved into- Arg-vasopressin (Arginine-vasopressin); Neurophysin 2 (Neurophysin-II); Copeptin] |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney; it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B; V1aR/AVPR1A; and V2R/AVPR2). |
| Length | 166 |
| Molecular Weight | 17 |
| Name | Vasopressin-neurophysin 2-copeptin |
| Sequence | AMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRV |
| Sequence map | 2280 |
| PDB ID | 6276766; 6709064; 3768139; 13115463; 3318825; 1252249; 1248642; 4564211; 465021; 2034668; |
| Drugpedia | 1JK4;1JK6;1NPO;2BN2; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|