| Primary information |
|---|
| ID | 13110 |
| Uniprot ID | P49192 |
| Description | Cocaine- and amphetamine-regulated transcript protein [Cleaved into- CART(1-52); CART(55-102); CART(62-102)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the CART family. |
| Tissue Specificity | Neuroendocrine tissues. Predominantly expressed in the hypothalamus; pituitary; and longitudinal muscle-myenteric plexus. Abundant expression is also seen in the midbrain/thalamus and eye. A lower lev |
| Post Translational Modification | NA |
| Function | Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. |
| Length | 129 |
| Molecular Weight | 14 |
| Name | Cocaine- and amphetamine-regulated transcript protein |
| Sequence | IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
| Sequence map | 1152 |
| PDB ID | 7891182; 9654146; 22673903 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|