| Primary information |
|---|
| ID | 13106 |
| Uniprot ID | C0HJI3 |
| Description | Insulin-2 [Cleaved into- Insulin-2 B chain; Insulin-2 A chain] |
| Organism | Katsuwonus pelamis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Pelagiaria; Scombriformes; Scombridae (mackerels); Scombrinae; Thunnini; Katsuwonus; Katsuwonus pelamis (Skipjack tuna) (Bonito) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver. |
| Length | 51 |
| Molecular Weight | 5 |
| Name | Insulin-2 |
| Sequence | AAPPQHLCGSHLVDALYLVCGERGFFYNPK |
| Sequence map | 720 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|