| Primary information |
|---|
| ID | 13098 |
| Uniprot ID | P01186 |
| Description | Vasopressin-neurophysin 2-copeptin (AVP-NPII) [Cleaved into- Arg-vasopressin (Arginine-vasopressin); Neurophysin 2 (Neurophysin-I); Copeptin] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney; it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B; V1aR/AVPR1A; and V2R/AVPR2). |
| Length | 168 |
| Molecular Weight | 17 |
| Name | Vasopressin-neurophysin 2-copeptin |
| Sequence | ATSDMELRQCLPCGPGGKGRCFGPSICCADELGCFLGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSDESCVAEPECREGFFRLT |
| Sequence map | 2232 |
| PDB ID | 1706187; 3768139; 6315416; 6526016; 5150741; 7036996; 891987; 6641941; 3956504 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|