| Primary information |
|---|
| ID | 13096 |
| Uniprot ID | P01185 |
| Description | Vasopressin-neurophysin 2-copeptin (AVP-NPII) [Cleaved into- Arg-vasopressin (Arginine-vasopressin); Neurophysin 2 (Neurophysin-II); Copeptin] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | [Neurophysin 2]- Specifically binds vasopressin.; [Arg-vasopressin]- Has a direct antidiuretic action on the kidney; it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B; V1aR/AVPR1A; and V2R/AVPR2) |
| Length | 164 |
| Molecular Weight | 17 |
| Name | Vasopressin-neurophysin 2-copeptin |
| Sequence | AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA |
| Sequence map | 2232 |
| PDB ID | 2991279; 3768139; 4065330; 1740104; 11780052; 15489334; 13591312; 6574452; 7271787; 3371362 |
| Drugpedia | 7KH0; |
| Receptor | P47901; P30518 |
| Domain | NA |
| Pharmaceutical Use | NA
|