Primary information |
---|
ID | 13096 |
Uniprot ID | P01185 |
Description | Vasopressin-neurophysin 2-copeptin (AVP-NPII) [Cleaved into- Arg-vasopressin (Arginine-vasopressin); Neurophysin 2 (Neurophysin-II); Copeptin] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the vasopressin/oxytocin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | [Neurophysin 2]- Specifically binds vasopressin.; [Arg-vasopressin]- Has a direct antidiuretic action on the kidney; it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B; V1aR/AVPR1A; and V2R/AVPR2) |
Length | 164 |
Molecular Weight | 17 |
Name | Vasopressin-neurophysin 2-copeptin |
Sequence | AMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA |
Sequence map | 2232 |
PDB ID | 2991279; 3768139; 4065330; 1740104; 11780052; 15489334; 13591312; 6574452; 7271787; 3371362 |
Drugpedia | 7KH0; |
Receptor | P47901; P30518 |
Domain | NA |
Pharmaceutical Use | NA
|