Primary information |
---|
ID | 13093 |
Uniprot ID | P07456 |
Description | Insulin-like growth factor II (IGF-II) (Erythrotropin) [Cleaved into- Insulin-like growth factor II; Preptin] |
Organism | Bos taurus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insulin family. |
Tissue Specificity | NA |
Post Translational Modification | Proteolytically processed by PCSK4; proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2. |
Function | The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults; involved in glucose metabolism in adipose tissue; skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators; thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate. |
Length | 179 |
Molecular Weight | 19 |
Name | Insulin-like growth factor II |
Sequence | DVSASTTVLPDDVTAYPVGKFFQYDIWKQSTQRL |
Sequence map | 816 |
PDB ID | 16120826; 3941093; 3390164; 2302223; 2388846; 1280544; 19674964 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|