| Primary information |
|---|
| ID | 13092 |
| Uniprot ID | P07456 |
| Description | Insulin-like growth factor II (IGF-II) (Erythrotropin) [Cleaved into- Insulin-like growth factor II; Preptin] |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | Proteolytically processed by PCSK4; proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2. |
| Function | The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults; involved in glucose metabolism in adipose tissue; skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators; thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate. |
| Length | 179 |
| Molecular Weight | 19 |
| Name | Insulin-like growth factor II |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Sequence map | 1608 |
| PDB ID | 16120826; 3941093; 3390164; 2302223; 2388846; 1280544; 19674964 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|