| Primary information |
|---|
| ID | 13060 |
| Uniprot ID | Q9R0R3 |
| Description | Apelin (APJ endogenous ligand) [Cleaved into- Apelin-36; Apelin-31; Apelin-28; Apelin-13] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | Highly expressed in neonatal tissues. In the adult; reaches a maximal level around parturition. |
| Similarity | Belongs to the apelin family. |
| Tissue Specificity | Expressed in the lung; testis; ovary; uterus and mammary gland (PubMed-11336787). Expressed in neurons in the thalamic paraventricular and hypothalamic supraoptic nuclei (PubMed-11359874). The lung; t |
| Post Translational Modification | Several active peptides may be produced by proteolytic processing of the peptide precursor. |
| Function | Endogenous ligand for the apelin receptor (APLNR) |
| Length | 77 |
| Molecular Weight | 8 |
| Name | Apelin |
| Sequence | LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF |
| Sequence map | 864 |
| PDB ID | 10525157; 10617103; 15489334; 11336787; 11359874; 26611206 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|