| Primary information |
|---|
| ID | 13055 |
| Uniprot ID | Q9GSA4 |
| Description | Pro-corazonin (Crz) [Cleaved into- Corazonin; Corazonin precursor-related peptide (CPRP)] |
| Organism | Galleria mellonella |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Pyraloidea; Pyralidae (snout moths); Galleriinae; Galleria; Galleria mellonella (Greater wax moth) |
| Subcellular Location | [Corazonin]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the corazonin family. |
| Tissue Specificity | Four pairs of lateral neurosecretory cells in the brains of late instar larvae; pupae and adults. |
| Post Translational Modification | NA |
| Function | Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. |
| Length | 113 |
| Molecular Weight | 12 |
| Name | Pro-corazonin |
| Sequence | DGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY |
| Sequence map | 1920 |
| PDB ID | 11520357 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|