| Primary information |
|---|
| ID | 13034 |
| Uniprot ID | P05059 |
| Description | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) [Cleaved into- Vasostatin-1; Chromofungin; Chromostatin; Chromacin; Pancreastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor] |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | [Serpinin]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the chromogranin/secretogranin protein family. |
| Tissue Specificity | Highest concentration of GE-25 found in adrenal medulla with lower levels present in the pituitary; the intestinal mucosa and the pancreas. Also found in the brain. |
| Post Translational Modification | In secretory granules; is attacked at both N- and C-terminal sides by proteolytic enzymes generating numerous peptides of various activities. Proteolytic processing can give rise to additional longer |
| Function | [Pancreastatin]- Strongly inhibits glucose induced insulin release from the pancreas. |
| Length | 449 |
| Molecular Weight | 50 |
| Name | Chromogranin-A |
| Sequence | LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKELQDLALQGAKERTHQQ |
| Sequence map | 1824 |
| PDB ID | 1779968; 3755681; 3018587; 3474638; 9074643; 12795588; 1986917; 2387861; 8243650; 1996343; |
| Drugpedia | 1CFK;1N2Y; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|