Primary information |
---|
ID | 13018 |
Uniprot ID | Q16568 |
Description | Cocaine- and amphetamine-regulated transcript protein [Cleaved into- CART(1-39); CART(42-89)] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the CART family. |
Tissue Specificity | Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus; in the external zone of the median eminence; and also found in terminals in the periventricular part of the paraventric |
Post Translational Modification | NA |
Function | Satiety factor closely associated with the actions of leptin and neuropeptide Y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro. |
Length | 116 |
Molecular Weight | 12 |
Name | Cocaine- and amphetamine-regulated transcript protein |
Sequence | QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKS |
Sequence map | 936 |
PDB ID | 8647455; 15489334; 15340161; 9590691; 11478874; 10905499; 11522684 |
Drugpedia | 1HY9; |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|