| Primary information |
|---|
| ID | 13016 |
| Uniprot ID | P09558 |
| Description | Endothelin-1 (ET-1) (Preproendothelin-1) (PPET1) [Cleaved into- Big endothelin-1] |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the endothelin/sarafotoxin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Endothelins are endothelium-derived vasoconstrictor peptides |
| Length | 203 |
| Molecular Weight | 23 |
| Name | Endothelin-1 |
| Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHIVP |
| Sequence map | 720 |
| PDB ID | 2451132; 2669747; 2665739; 2205205 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|