| Primary information |
|---|
| ID | 13003 |
| Uniprot ID | P10645 |
| Description | Chromogranin-A (CgA) (Pituitary secretory protein I) (SP-I) [Cleaved into- Vasostatin-1 (Vasostatin I); Vasostatin-2 (Vasostatin II); EA-92; ES-43; Pancreastatin; SS-18; WA-8; WE-14; LF-19; Catestatin (SL21); AL-11; GV-19; GR-44; ER-37; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Serpinin]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the chromogranin/secretogranin protein family. |
| Tissue Specificity | GE-25 is found in the brain. |
| Post Translational Modification | Sulfated on tyrosine residues and/or contains sulfated glycans.; O-glycosylated with core 1 or possibly core 8 glycans. |
| Function | [Pancreastatin]- Strongly inhibits glucose induced insulin release from the pancreas.; [Catestatin]- Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist |
| Length | 457 |
| Molecular Weight | 50 |
| Name | Chromogranin-A |
| Sequence | EDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQA |
| Sequence map | 2208 |
| PDB ID | 2445752; 3403545; 8120054; 14702039; 12508121; 15489334; 3704195; 2165909; 2830133; 1577173 |
| Drugpedia | 1LV4;6R2X; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|