Primary information |
---|
ID | 12987 |
Uniprot ID | Q5DW47 |
Description | Pro-corazonin (AmCrz) (Crz) [Cleaved into- Corazonin; Corazonin precursor-related peptide (CPRP)] |
Organism | Apis mellifera |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee) |
Subcellular Location | [Corazonin]- Secreted; [Corazonin precursor-related peptide]- Secreted |
Developmental Stage | NA |
Similarity | Belongs to the corazonin family. |
Tissue Specificity | In the adult brain; expressed in four neurons of the lateral protocerebrum project axons towards the retrocerebral complex. |
Post Translational Modification | NA |
Function | Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. |
Length | 107 |
Molecular Weight | 12 |
Name | Pro-corazonin |
Sequence | QTFTYSHGWTNGKRSTSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFPKRSFSENMINDHRQPAPTNNNY |
Sequence map | 2064 |
PDB ID | 16406615; 17068263 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|