| Primary information |
|---|
| ID | 12986 |
| Uniprot ID | Q5DW47 |
| Description | Pro-corazonin (AmCrz) (Crz) [Cleaved into- Corazonin; Corazonin precursor-related peptide (CPRP)] |
| Organism | Apis mellifera |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee) |
| Subcellular Location | [Corazonin]- Secreted; [Corazonin precursor-related peptide]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the corazonin family. |
| Tissue Specificity | In the adult brain; expressed in four neurons of the lateral protocerebrum project axons towards the retrocerebral complex. |
| Post Translational Modification | NA |
| Function | Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. |
| Length | 107 |
| Molecular Weight | 12 |
| Name | Pro-corazonin |
| Sequence | STSLEELANRNAIQSDNVFANCELQKLRLLLQGNINNQLFQTPCELLNFP |
| Sequence map | 1200 |
| PDB ID | 16406615; 17068263 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|