| Primary information |
|---|
| ID | 12984 |
| Uniprot ID | Q26377 |
| Description | Pro-corazonin (Crz) (Dm-Crz) [Cleaved into- Corazonin; Corazonin precursor-related peptide (CPRP) (Crz-associated peptide)] |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | [Corazonin]- Secreted; [Corazonin precursor-related peptide]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the corazonin family. |
| Tissue Specificity | From late embryo to larva; expression is consistently detected in three neuronal groups- dorso-lateral neurons (DL); dorso-medial neurons (DM); and neurons in the ventral nerve cord (vCrz). Both the v |
| Post Translational Modification | NA |
| Function | Cardioactive peptide. Corazonin is probably involved in the physiological regulation of the heart beat. Clock (Clk) and cycle (cyc) proteins negatively regulate Crz transcription in a cell-specific manner. |
| Length | 154 |
| Molecular Weight | 17 |
| Name | Pro-corazonin |
| Sequence | SFNAASPLLANGHLHRASELGLTDLYDLQDWSSD |
| Sequence map | 816 |
| PDB ID | 10731132; 12537572; 7945373; 12171930; 15174081; 15669053; 18087727 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|