| Primary information |
|---|
| ID | 12970 |
| Uniprot ID | Q9BDP9 |
| Description | Cocaine- and amphetamine-regulated transcript protein [Cleaved into- CART(55-102); CART(62-102)] (Fragment) |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the CART family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. |
| Length | 66 |
| Molecular Weight | 7 |
| Name | Cocaine- and amphetamine-regulated transcript protein |
| Sequence | YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLK |
| Sequence map | 936 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|