| Primary information |
|---|
| ID | 12967 |
| Uniprot ID | P04404 |
| Description | Chromogranin-A (CgA) [Cleaved into- Pancreastatin; Parastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor] (Fragment) |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | [Serpinin]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the chromogranin/secretogranin protein family. |
| Tissue Specificity | NA |
| Post Translational Modification | O-glycosylated.; Parathyroid CHGA is sulfated on tyrosine residues; whereas adrenal CHGA seems to be mainly sulfated on oligosaccharide residues. |
| Function | [Pancreastatin]- Strongly inhibits glucose induced insulin release from the pancreas.; [Parastatin]- Inhibits low calcium-stimulated parathyroid cell secretion.; [Catestatin]- Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Can induce mast cell migration; degranulation and production of cytokines and chemokines. |
| Length | 446 |
| Molecular Weight | 49 |
| Name | Chromogranin-A |
| Sequence | LSFRAPAYGFRGPGLQLRRGWRPSSREDSVEAGLPLQVRXYLEEKKEEEGSANRRPEDQELESLSAIEAELEK |
| Sequence map | 1752 |
| PDB ID | 2834189; 3537810; 8344192; 2105940 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|