Primary information |
---|
ID | 12965 |
Uniprot ID | P04404 |
Description | Chromogranin-A (CgA) [Cleaved into- Pancreastatin; Parastatin; WE-14; Catestatin; GE-25; Serpinin-RRG; Serpinin; p-Glu serpinin precursor] (Fragment) |
Organism | Sus scrofa |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
Subcellular Location | [Serpinin]- Secreted |
Developmental Stage | NA |
Similarity | Belongs to the chromogranin/secretogranin protein family. |
Tissue Specificity | NA |
Post Translational Modification | O-glycosylated.; Parathyroid CHGA is sulfated on tyrosine residues; whereas adrenal CHGA seems to be mainly sulfated on oligosaccharide residues. |
Function | [Pancreastatin]- Strongly inhibits glucose induced insulin release from the pancreas.; [Parastatin]- Inhibits low calcium-stimulated parathyroid cell secretion.; [Catestatin]- Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Can induce mast cell migration; degranulation and production of cytokines and chemokines. |
Length | 446 |
Molecular Weight | 49 |
Name | Chromogranin-A |
Sequence | GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG |
Sequence map | 1176 |
PDB ID | 2834189; 3537810; 8344192; 2105940 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|