Primary information |
---|
ID | 12960 |
Uniprot ID | P10683 |
Description | Galanin peptides [Cleaved into- Galanin; Galanin message-associated peptide (GMAP)] |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the galanin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1; GALR2; and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract; growth hormone and insulin release and adrenal secretion. |
Length | 124 |
Molecular Weight | 13 |
Name | Galanin peptides |
Sequence | ELPLEVEEGRLGSVAVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEQS |
Sequence map | 1440 |
PDB ID | 2448788; 2445750 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|