| Primary information |
|---|
| ID | 12951 |
| Uniprot ID | P13205 |
| Description | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into- Brain natriuretic peptide 45 (BNP-45) (5 kDa cardiac natriuretic peptide) (Brain natriuretic peptide) (BNP)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | [Brain natriuretic peptide 45]- Secreted |
| Developmental Stage | Expressed in the atria and ventricles throughout postnatal development and in adults. |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | Expressed in the atria and ventricles; but at much lower levels than NPPA (PubMed-1837590). Expression levels in the ventricles are slightly higher than in the atria (PubMed-1837590). Very low levels |
| Post Translational Modification | The precursor molecule is proteolytically cleaved by the endoprotease Furin to produce brain natriuretic peptide 45 (PubMed-9252368). May undergo further proteolytic cleavage by various proteases such |
| Function | [Brain natriuretic peptide 45]- Cardiac hormone that plays a key role in mediating cardio-renal homeostasis |
| Length | 121 |
| Molecular Weight | 13 |
| Name | Natriuretic peptides B |
| Sequence | HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF |
| Sequence map | 2280 |
| PDB ID | 2522776; 2144113; 1837590; 2673236; 2528349; 2525380; 2525379; 9252368 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|