| Primary information |
|---|
| ID | 12948 |
| Uniprot ID | P07634 |
| Description | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into- NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); Brain natriuretic peptide 32 (BNP-32); Brain natriuretic peptide 26 (BNP-26)] |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | Heart atrium. |
| Post Translational Modification | The precursor molecule is proteolytically cleaved by the endoproteases FURIN or CORIN at Arg-99 to produce the active brain natriuretic peptide 32 and the inactive NT-proBNP. CORIN also cleaves the pr |
| Function | [Brain natriuretic peptide 32]- Cardiac hormone that plays a key role in mediating cardio-renal homeostasis. May also function as a paracrine antifibrotic factor in the heart. Acts by specifically binding and stimulating NPR1 to produce cGMP; which in turn activates effector proteins that drive various biological responses. Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis; diuresis; vasorelaxation; and inhibition of renin and aldosterone secretion. Binds the clearance receptor NPR3. |
| Length | 131 |
| Molecular Weight | 14 |
| Name | Natriuretic peptides B |
| Sequence | SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY |
| Sequence map | 768 |
| PDB ID | 3196348; 2708334; 3196347; 3421965; 2964562; 2146114; 1915362 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|